PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010927239.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family HB-PHD
Protein Properties Length: 609aa    MW: 68847.5 Da    PI: 6.5068
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010927239.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox34.92.6e-113513931153
                     HHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
        Homeobox  11 qleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                      +e L ++F++n  ps++ +e L+k+lg++ ++V+ WF+N R+
  XP_010927239.1 351 AVEKLRQVFAENELPSRTVKENLSKQLGISSEKVSKWFKNARY 393
                     5789**************************************7 PP

2PHD30.48.9e-1177130151
                     SBTTTSS..TCTTSSEEEBS.SSSSEEETTTSTSSSSHHSHHSSTBSSHHHHTT CS
             PHD   1 rCkvCgk..sdeegelvlCd.gCkewfHlkClglkleseekpegewlCeeCkek 51 
                     +C+ C++  +  +++++lCd +C+  fH+kCl+++le+ +  ++ wlC+ C++k
  XP_010927239.1  77 FCAKCRSreAFPDNDIILCDgTCNCGFHQKCLEPPLENIPPGDQVWLCKFCECK 130
                     588888855455********56***************8888888*******985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579032.26E-1368132IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.102.5E-1273131IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS5001610.46975130IPR019787Zinc finger, PHD-finger
PROSITE patternPS01359075127IPR019786Zinc finger, PHD-type, conserved site
SMARTSM002497.9E-777128IPR001965Zinc finger, PHD-type
CDDcd155041.29E-2677127No hitNo description
PfamPF006282.8E-877130IPR019787Zinc finger, PHD-finger
Gene3DG3DSA:1.10.10.606.2E-12335392IPR009057Homeodomain-like
PROSITE profilePS5007112.244338398IPR001356Homeobox domain
SMARTSM003892.4E-8340402IPR001356Homeobox domain
CDDcd000861.02E-8341399No hitNo description
SuperFamilySSF466895.56E-10341402IPR009057Homeodomain-like
PfamPF000468.9E-9351393IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 609 aa     Download sequence    Send to blast
MKLEQNLIDA YSGDGWNGHS REKIKPENEL QRAKKQILKC KLGIRDAIHQ LDLLSSIGSI  60
EDSVMHPDGS VFHECIFCAK CRSREAFPDN DIILCDGTCN CGFHQKCLEP PLENIPPGDQ  120
VWLCKFCECK TEILEAVNAH LGTCFSANSR WEDIFKEATT DPDVENTYLN PAEDWPSEDS  180
EDEDYNPEKN VNSASRTGIA ENMTGDSSSS SSLFCSSDGA MSCSESIHTY SNGKSCDVEH  240
KEGNEANFVD SIINAEYGET NDCEIMSYQR QRRDVDYKKL HDDMFGKDLA DNEHQSEDED  300
WCPHRSTRRR IKSTTGTTLA KCVNEDGCAD IVLTEKISHE KKPLFRIPLN AVEKLRQVFA  360
ENELPSRTVK ENLSKQLGIS SEKVSKWFKN ARYAALKMRK AGITKSHHVN TITKRSRVSA  420
GKAGSFDEVA SVDNSILLPL SSIIHVGRNL RKILQKKNKK SMNIPLRMHL KTTANTDSTK  480
EFQNLGTSLT ANQCPSISIH RNLSKEVSTS LTNTMILKKE VSGLRRKFTL GRTFRAKRRN  540
VFQIDEMIDS EQLYVAEIER LCSLENRLRN LKNALLLCEY NDYESVKTHS TEENVTYVPV  600
AEVKEQAFI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010927238.10.0PREDICTED: pathogenesis-related homeodomain protein-like isoform X1
TrEMBLM0TT420.0M0TT42_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr8P23890_0010.0(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29940.11e-116pathogenesis related homeodomain protein A